RetrogeneDB ID: | retro_cjac_2937 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 7:118280728..118280928(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDCD5 | ||
Ensembl ID: | ENSCJAG00000018410 | ||
Aliases: | None | ||
Description: | programmed cell death 5 [Source:HGNC Symbol;Acc:8764] |
Percent Identity: | 89.71 % |
Parental protein coverage: | 53.6 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LSNLALVKPEKTKAVENYLIQMARYGQISEKVS-EQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDED |
.SNLALVKPEKT.AVENYLIQMARYGQISE.VS..QGL.EILKKVSQQTEKTT.VKFNRRKVMDSDED | |
Retrocopy | VSNLALVKPEKTQAVENYLIQMARYGQISEMVS<KQGLMEILKKVSQQTEKTTAVKFNRRKVMDSDED |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 9 .10 RPM |
SRP051959_heart | 0 .04 RPM | 15 .91 RPM |
SRP051959_kidney | 0 .00 RPM | 12 .67 RPM |
SRP051959_liver | 0 .00 RPM | 11 .72 RPM |
SRP051959_lung | 0 .00 RPM | 12 .01 RPM |
SRP051959_lymph_node | 0 .00 RPM | 17 .85 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 13 .95 RPM |
SRP051959_spleen | 0 .00 RPM | 15 .63 RPM |