RetrogeneDB ID: | retro_mdom_893 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 2:342189204..342189455(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PDCD5 | ||
| Ensembl ID: | ENSMODG00000012326 | ||
| Aliases: | None | ||
| Description: | programmed cell death 5 [Source:HGNC Symbol;Acc:8764] |
| Percent Identity: | 52.22 % |
| Parental protein coverage: | 69.6 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 3 |
| Parental | QEAKHREAEMRNNILAQVLDQSARARLSNLALVKP-EKAKAVENYLIQMAR-YGQLSGKVTEQGLI-EIL |
| Q..KHR..E.RN.IL..VLDQSA..RL.NLALV.P..K.K....YLI...R......GK..EQ.LI...L | |
| Retrocopy | QRGKHR*TEIRNHILP*VLDQSA*ERLDNLALVMP<NKTKIID-YLILIER>LRRVGGKFSEQILI<KFL |
| Parental | EKVSQQTEKKITVKFNRRKV |
| EK......KK..VKFNRRK. | |
| Retrocopy | EK*TNR--KKRAVKFNRRKM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 89 .52 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 74 .11 RPM |
| SRP007412_heart | 0 .00 RPM | 133 .77 RPM |
| SRP007412_kidney | 0 .00 RPM | 46 .09 RPM |
| SRP007412_liver | 0 .00 RPM | 74 .01 RPM |
| SRP007412_testis | 0 .00 RPM | 132 .20 RPM |