RetrogeneDB ID: | retro_chof_328 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | GeneScaffold_7401:9928..10166(-) | ||
Located in intron of: | ENSCHOG00000002617 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCHOG00000013008 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 80.25 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MARTMEPLAKKIFKAILVAEVMGIFGAYFLFNKMNTSQDFRETMSKKF-PFILEVYYKSLEHSGMYEIRE |
MA..M..LAK.IFK.ILVAEVMGIFGAYFLFNKMNTSQDFR.TMSKK..PFILE..YKSLEHSGM...R. | |
Retrocopy | MANPMQLLAK-IFKGILVAEVMGIFGAYFLFNKMNTSQDFRRTMSKKT>PFILEI*YKSLEHSGMCRTRQ |
Parental | QDQEKWMNSKN |
Q.QEKWMNSKN | |
Retrocopy | QNQEKWMNSKN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies |
retro_chof_328 , retro_chof_49,
|
Felis catus | ENSFCAG00000023228 | 2 retrocopies | |
Homo sapiens | ENSG00000218739 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies | |
Mus musculus | ENSMUSG00000062691 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |