RetrogeneDB ID: | retro_ttru_1069 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | scaffold_101942:115..325(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSTTRG00000006884 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 85.71 % |
Parental protein coverage: | 87.5 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KIFKGVLVAELVGVFGAYFLFKKMNTSQDFRQTMSKKFPFILEVYYKSIEHSGMYGIREQDQEKWLNSKN |
KIFKGVL.AELVG.FGAYF.FKKMNTSQ.F.QTMSKKFPFILE..YKSIEHSGMYGI.EQD.EKWLN.KN | |
Retrocopy | KIFKGVLLAELVGIFGAYFFFKKMNTSQGFMQTMSKKFPFILEIHYKSIEHSGMYGITEQDPEKWLNGKN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies | |
Felis catus | ENSFCAG00000023228 | 2 retrocopies | |
Homo sapiens | ENSG00000218739 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies | |
Mus musculus | ENSMUSG00000062691 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |
retro_ttru_1069 , retro_ttru_1866, retro_ttru_1946, retro_ttru_274, retro_ttru_526, retro_ttru_57, retro_ttru_832,
|