RetrogeneDB ID: | retro_ttru_832 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_3594:72095..72331(+) | ||
| Located in intron of: | ENSTTRG00000001453 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTTRG00000006884 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.0 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | ARTMDPLA-KKIFKGVLVAELVGVFGAYFLFKKMNTSQDFRQTMSKKFPFILEVYYKSIEHSGMYGIREQ |
| A....PLA.KKIFKGVLVA.LVG.FGAYFLFKKMN.SQDFRQTMSKKFPF.LEVYYKSI.HSGMY.IREQ | |
| Retrocopy | AHALEPLA<KKIFKGVLVAALVGIFGAYFLFKKMNASQDFRQTMSKKFPFVLEVYYKSIGHSGMYRIREQ |
| Parental | DQEKWLNSKN |
| .QEKWLNSKN | |
| Retrocopy | NQEKWLNSKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies | |
| Felis catus | ENSFCAG00000023228 | 2 retrocopies | |
| Homo sapiens | ENSG00000218739 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000062691 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |
retro_ttru_1069, retro_ttru_1866, retro_ttru_1946, retro_ttru_274, retro_ttru_526, retro_ttru_57, retro_ttru_832 ,
|