RetrogeneDB ID: | retro_fcat_1750 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | F1:22826460..22826619(+) | ||
Located in intron of: | ENSFCAG00000011286 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSFCAG00000023228 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 54.55 % |
Parental protein coverage: | 68.75 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | KIFKGVLVVELVGVFGAYFLFNKMNTSQDFRQTMSKKFPFILEVYYKSIEQSGMY |
KIFKG....ELV...G..FLFNK.NTSQDF...MSKKFPFI.......I.....Y | |
Retrocopy | KIFKGISIAELV-FWGT*FLFNK-NTSQDFSSVMSKKFPFI*NIHLYRIRKGFCY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 17 .67 RPM |
SRP017611_kidney | 0 .00 RPM | 16 .49 RPM |
SRP017611_liver | 0 .00 RPM | 15 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies | |
Felis catus | ENSFCAG00000023228 | 2 retrocopies |
retro_fcat_1289, retro_fcat_1750 ,
|
Homo sapiens | ENSG00000218739 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies | |
Mus musculus | ENSMUSG00000062691 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |