RetrogeneDB ID: | retro_mmus_426 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 1:30642076..30642316(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | 1110001A16Rik | ||
Ensembl ID: | ENSMUSG00000062691 | ||
Aliases: | None | ||
Description: | RIKEN cDNA 1110001A16 gene [Source:MGI Symbol;Acc:MGI:1915804] |
Percent Identity: | 92.5 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MARIMEPLARKIFKGVLAAELVGVAGAYCLFKKMHSSQDFRQTMSKKFPFILEVYYKSIEQSGMYGVREK |
MA..MEPLARKIFKGVLAAELVGVAGA..LFKKM.SSQDFRQTMSKKFPFILEVYYKSIEQSGMYGVREK | |
Retrocopy | MAWTMEPLARKIFKGVLAAELVGVAGAHFLFKKMNSSQDFRQTMSKKFPFILEVYYKSIEQSGMYGVREK |
Parental | DEEKWLTSKN |
D.EKWLTSKN | |
Retrocopy | DQEKWLTSKN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .02 RPM | 3 .15 RPM |
SRP007412_cerebellum | 0 .00 RPM | 2 .17 RPM |
SRP007412_heart | 0 .00 RPM | 6 .16 RPM |
SRP007412_kidney | 0 .00 RPM | 3 .85 RPM |
SRP007412_liver | 0 .00 RPM | 3 .47 RPM |
SRP007412_testis | 0 .00 RPM | 1 .60 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_73763 | 284 libraries | 414 libraries | 367 libraries | 7 libraries | 0 libraries |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies | |
Felis catus | ENSFCAG00000023228 | 2 retrocopies | |
Homo sapiens | ENSG00000218739 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies | |
Mus musculus | ENSMUSG00000062691 | 2 retrocopies |
retro_mmus_426 , retro_mmus_509,
|
Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |