RetrogeneDB ID: | retro_dnov_1645 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_254452:2..228(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V1G1 | ||
Ensembl ID: | ENSDNOG00000008083 | ||
Aliases: | None | ||
Description: | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864] |
Percent Identity: | 90.79 % |
Parental protein coverage: | 63.56 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKA-KEAAALGSHGSC |
MASQSQGIQQLLQAEKRAAE.VSEARKRKN.RLKQAKE.AQAE.EQY.LQREKEFKA.KEAAALGSHGSC | |
Retrocopy | MASQSQGIQQLLQAEKRAAE*VSEARKRKNQRLKQAKEAAQAETEQYCLQREKEFKA>KEAAALGSHGSC |
Parental | STEVEK |
STEVE. | |
Retrocopy | STEVEE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 80 .70 RPM |
SRP012922_cerebellum | 0 .00 RPM | 119 .05 RPM |
SRP012922_heart | 0 .00 RPM | 59 .86 RPM |
SRP012922_kidney | 0 .00 RPM | 150 .31 RPM |
SRP012922_liver | 0 .00 RPM | 54 .03 RPM |
SRP012922_lung | 0 .00 RPM | 142 .95 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 70 .10 RPM |
SRP012922_spleen | 0 .00 RPM | 144 .68 RPM |