RetrogeneDB ID: | retro_dnov_1754 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_288226:609..829(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL30 | ||
Ensembl ID: | ENSDNOG00000013828 | ||
Aliases: | None | ||
Description: | ribosomal protein L30 [Source:HGNC Symbol;Acc:10333] |
Percent Identity: | 89.47 % |
Parental protein coverage: | 64.35 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | KAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIE-LGTACG-KYYRVCTLAIIDPGDSDIIRSMP |
KAKLVILANN.PALRKSEIEYYA.LAKTGVHH.SG.NIE..GTACG.KYYRV.TLAIIDPGDSDIIRSMP | |
Retrocopy | KAKLVILANNRPALRKSEIEYYATLAKTGVHHCSGENIE<MGTACG<KYYRVSTLAIIDPGDSDIIRSMP |
Parental | EQTGEK |
EQTGEK | |
Retrocopy | EQTGEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 222 .47 RPM |
SRP012922_cerebellum | 0 .00 RPM | 134 .99 RPM |
SRP012922_heart | 0 .00 RPM | 171 .24 RPM |
SRP012922_kidney | 0 .00 RPM | 308 .57 RPM |
SRP012922_liver | 0 .00 RPM | 175 .86 RPM |
SRP012922_lung | 0 .00 RPM | 422 .89 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 214 .97 RPM |
SRP012922_spleen | 0 .00 RPM | 422 .02 RPM |