RetrogeneDB ID: | retro_dnov_2529 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_83012:3954..4341(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TSEN15 | ||
Ensembl ID: | ENSDNOG00000017611 | ||
Aliases: | None | ||
Description: | tRNA splicing endonuclease 15 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:16791] |
Percent Identity: | 81.06 % |
Parental protein coverage: | 76.19 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | PKYLEMMELDIGDATQVYIAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPISAS |
PKYLEMMELDIGD.TQVYIAFLV.LDLME.K......CVGLPELQLICL.GTE.E.....TVVP.PISAS | |
Retrocopy | PKYLEMMELDIGDSTQVYIAFLVCLDLMENKI---IPCVGLPELQLICLGGTELER*EFLTVVPAPISAS |
Parental | LSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQ----NISLRR |
LSHNRIREILK.S.KLQG.PDLPMSFTLAIVESDSTIVYYKLT.GFMLPDPQ....NISLRR | |
Retrocopy | LSHNRIREILKSSQKLQGNPDLPMSFTLAIVESDSTIVYYKLTNGFMLPDPQVSFENISLRR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 9 .14 RPM |
SRP012922_cerebellum | 0 .00 RPM | 7 .84 RPM |
SRP012922_heart | 0 .00 RPM | 5 .80 RPM |
SRP012922_kidney | 0 .00 RPM | 7 .12 RPM |
SRP012922_liver | 0 .00 RPM | 4 .18 RPM |
SRP012922_lung | 0 .15 RPM | 7 .79 RPM |
SRP012922_quadricep_muscle | 0 .17 RPM | 3 .63 RPM |
SRP012922_spleen | 0 .00 RPM | 10 .30 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000016369 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005356 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000017611 | 2 retrocopies |
retro_dnov_1176, retro_dnov_2529 ,
|
Homo sapiens | ENSG00000198860 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015804 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000014109 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016409 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000011790 | 1 retrocopy | |
Mus musculus | ENSMUSG00000014980 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000018024 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000003128 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000421 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000023202 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000001103 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000013230 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000002941 | 2 retrocopies |