RetrogeneDB ID: | retro_ecab_353 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 15:80421086..80421323(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UFM1 | ||
Ensembl ID: | ENSECAG00000014564 | ||
Aliases: | None | ||
Description: | ubiquitin-fold modifier 1 [Source:HGNC Symbol;Acc:20597] |
Percent Identity: | 61.45 % |
Parental protein coverage: | 94.12 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | FKITLTSD-PRLPYKVLSVPEGTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGS-E |
FKITL..D.P.L.YK.LS.PE.TPFTAVLKFAA.EF.VP.AT.A.ITN.GI.INP.QT....FLK..S.. | |
Retrocopy | FKITLMMD<PWLLYKELSFPESTPFTAVLKFAAAEFEVPPATTAVITNNGIEINPEQTTRDIFLKYVS<S |
Parental | LRIIPR-DRVGSC |
..I.P.....GSC | |
Retrocopy | VQIVPK<NNTGSC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 3 .66 RPM |
SRP021940_cerebellum | 0 .00 RPM | 5 .76 RPM |
SRP021940_embryo | 0 .00 RPM | 11 .48 RPM |
SRP021940_placental_villous | 0 .00 RPM | 9 .00 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 6 .92 RPM |
SRP021940_testis | 0 .00 RPM | 7 .67 RPM |