RetrogeneDB ID: | retro_rnor_2202 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 5:24374772..24374923(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ufm1 | ||
| Ensembl ID: | ENSRNOG00000038176 | ||
| Aliases: | Ufm1, RGD1304890 | ||
| Description: | Ubiquitin-fold modifier 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5BJP3] |
Retrocopy-Parental alignment summary:
>retro_rnor_2202
TACAAAGTTCTCACTGTTCCTGAAAGTGCTCCTCTCTACAGCAGTGTTGAAGTTTGCAGCAGGAAAATGTACAGTTCCAA
TAGCAACACCAGTAATTATTACCAATGATGGGGTATGAATAAATCCTGCAGAGACTGGTGGCAATGTTTTC
ORF - retro_rnor_2202 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 70.59 % |
| Parental protein coverage: | 58.82 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | YKVLSVPESTPF-TAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVF |
| YKVL.VPES.P..TAVLKFAA....VP.AT..IITNDG..INPA.T.GNVF | |
| Retrocopy | YKVLTVPESAPL>TAVLKFAAGKCTVPIATPVIITNDGV*INPAETGGNVF |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 19 .48 RPM |
| SRP017611_kidney | 0 .00 RPM | 38 .59 RPM |
| SRP017611_liver | 0 .00 RPM | 25 .62 RPM |
Rattus norvegicus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_rnor_2202 retrocopy.
Rattus norvegicus was not studied using FANTOM5 data.
retro_rnor_2202 was not experimentally validated.