RetrogeneDB ID: | retro_ggor_2970 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | X:143567520..143567683(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UFM1 | ||
Ensembl ID: | ENSGGOG00000026214 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.16 % |
Parental protein coverage: | 53.4 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | TGACEERLSVPEST-PFTAVLKFA-AEEFKVPAATSAIITNDGIGINPAQTAGNVFL |
..A.E....V.EST..F..VLKFA..E.FK..A.TSAI.TND.IGIN.AQTAGNVFL | |
Retrocopy | SAAIENTQGVLEST<TFPVVLKFA<TE*FKDLAGTSAINTNDRIGINTAQTAGNVFL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .40 RPM |
SRP007412_cerebellum | 0 .00 RPM | 9 .30 RPM |
SRP007412_heart | 0 .00 RPM | 1 .75 RPM |
SRP007412_kidney | 0 .00 RPM | 22 .08 RPM |
SRP007412_liver | 0 .00 RPM | 17 .33 RPM |
SRP007412_testis | 0 .00 RPM | 13 .57 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4767 |
Pan troglodytes | retro_ptro_3174 |
Pongo abelii | retro_pabe_3710 |
Macaca mulatta | retro_mmul_2542 |