RetrogeneDB ID: | retro_ggor_2168 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 5:48722499..48722694(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UFM1 | ||
Ensembl ID: | ENSGGOG00000026214 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 87.69 % |
Parental protein coverage: | 63.11 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC |
L..PESTPFTAVLKFAAEEFK.PAATSA.ITNDGIGIN.AQTAG.VFLK.GSELRIIPRD.VGSC | |
Retrocopy | LYLPESTPFTAVLKFAAEEFKAPAATSAVITNDGIGINLAQTAGSVFLKQGSELRIIPRDHVGSC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .40 RPM |
SRP007412_cerebellum | 0 .00 RPM | 9 .30 RPM |
SRP007412_heart | 0 .00 RPM | 1 .75 RPM |
SRP007412_kidney | 0 .00 RPM | 22 .08 RPM |
SRP007412_liver | 0 .00 RPM | 17 .33 RPM |
SRP007412_testis | 0 .00 RPM | 13 .57 RPM |