RetrogeneDB ID: | retro_eeur_50 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | GeneScaffold_2711:886609..886828(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RSL24D1 | ||
Ensembl ID: | ENSEEUG00000006755 | ||
Aliases: | None | ||
Description: | ribosomal L24 domain containing 1 [Source:HGNC Symbol;Acc:18479] |
Percent Identity: | 79.45 % |
Parental protein coverage: | 53.68 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | DAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQKLQEDMDME |
DAMKRVEEIKQK.QAKFI.NRL..N.ELQKVQ.IKEVK.NIHLI..PLAGKGKQLEE..VQK.Q.D.DME | |
Retrocopy | DAMKRVEEIKQKCQAKFIINRLN*N*ELQKVQYIKEVKRNIHLIQSPLAGKGKQLEEETVQKRQQDVDME |
Parental | DVS |
D.S | |
Retrocopy | DIS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .32 RPM | 15 .63 RPM |
SRP017611_kidney | 2 .25 RPM | 27 .76 RPM |
SRP017611_liver | 0 .80 RPM | 13 .51 RPM |