RetrogeneDB ID: | retro_dnov_858 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_114772:3335..3584(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RSL24D1 | ||
| Ensembl ID: | ENSDNOG00000010812 | ||
| Aliases: | None | ||
| Description: | ribosomal L24 domain containing 1 [Source:HGNC Symbol;Acc:18479] |
| Percent Identity: | 90.36 % |
| Parental protein coverage: | 50.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | CYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRR |
| CYFC.G.IYPGHGMMF..NDCKVFRFCKSKCHKNFKKKRNPRK.RWTKAFRK.A.KELTVDNSFEFEK.R | |
| Retrocopy | CYFCLGLIYPGHGMMFDHNDCKVFRFCKSKCHKNFKKKRNPRKDRWTKAFRKVAAKELTVDNSFEFEKCR |
| Parental | NEPVKYQRELWNK |
| NEPVKYQRELWNK | |
| Retrocopy | NEPVKYQRELWNK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 1 .36 RPM | 20 .81 RPM |
| SRP012922_cerebellum | 1 .51 RPM | 20 .07 RPM |
| SRP012922_heart | 0 .00 RPM | 14 .62 RPM |
| SRP012922_kidney | 0 .82 RPM | 24 .92 RPM |
| SRP012922_liver | 0 .62 RPM | 13 .47 RPM |
| SRP012922_lung | 0 .61 RPM | 23 .67 RPM |
| SRP012922_quadricep_muscle | 1 .21 RPM | 24 .58 RPM |
| SRP012922_spleen | 1 .03 RPM | 24 .95 RPM |