RetrogeneDB ID: | retro_fcat_1837 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | F2:20425448..20425659(-) | ||
Located in intron of: | ENSFCAG00000025043 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC19 | ||
Ensembl ID: | ENSFCAG00000010591 | ||
Aliases: | None | ||
Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
Percent Identity: | 73.24 % |
Parental protein coverage: | 54.26 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | QASTVVAVGLTIAAAGFAGRY-VLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGI |
.A.TVVA.GLTI.AAGFAG.Y..L.A..H.EP..KQ.FQSLPKSAFSG.YYRGGFEP.MTK.EAALI.G. | |
Retrocopy | RANTVVANGLTITAAGFAGCY>IL*AINHTEPKAKQAFQSLPKSAFSGRYYRGGFEPEMTK*EAALIAGV |
Parental | S |
S | |
Retrocopy | S |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 13 .31 RPM |
SRP017611_kidney | 0 .00 RPM | 20 .41 RPM |
SRP017611_liver | 0 .00 RPM | 38 .52 RPM |