RetrogeneDB ID: | retro_fcat_338 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | A2:100949851..100950274(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSFCAG00000028446 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.34 % |
Parental protein coverage: | 55.95 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNTLIA |
.VLQLL.L.QIF.GTFVKLNKAS..ML.IV.PYIA.GYP.LK.VNE.I.K.GY.KIN.K.I.LTD.TLI. | |
Retrocopy | QVLQLLCLSQIFHGTFVKLNKASIDMLKIVKPYIARGYPTLKLVNEMICKHGYDKINEK*ITLTDKTLIV |
Parental | RSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRR |
.S.GKYGII.MEDL.HEIY..GK..KEANNFLWPF.LSSP..GMKKK...FV.GGDA.NREDQI...IRR | |
Retrocopy | QSPGKYGIIYMEDLNHEIYIDGKHLKEANNFLWPFRLSSPQVGMKKKSICFVAGGDADNREDQIKSFIRR |
Parental | M |
M | |
Retrocopy | M |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 224 .84 RPM |
SRP017611_kidney | 0 .00 RPM | 1226 .90 RPM |
SRP017611_liver | 0 .00 RPM | 467 .84 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001821 | 5 retrocopies | |
Canis familiaris | ENSCAFG00000008021 | 28 retrocopies |
retro_cfam_1039, retro_cfam_1075, retro_cfam_1079, retro_cfam_1167, retro_cfam_1209, retro_cfam_1236, retro_cfam_1270, retro_cfam_1308, retro_cfam_1390, retro_cfam_1436, retro_cfam_1445, retro_cfam_1453, retro_cfam_1524, retro_cfam_1541, retro_cfam_1699, retro_cfam_1755, retro_cfam_1855, retro_cfam_1856, retro_cfam_2051, retro_cfam_2192, retro_cfam_338, retro_cfam_403, retro_cfam_563, retro_cfam_609, retro_cfam_737, retro_cfam_74, retro_cfam_922, retro_cfam_998,
|
Dasypus novemcinctus | ENSDNOG00000017654 | 15 retrocopies | |
Felis catus | ENSFCAG00000009707 | 1 retrocopy | |
Felis catus | ENSFCAG00000028446 | 6 retrocopies | |
Latimeria chalumnae | ENSLACG00000003571 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016319 | 9 retrocopies | |
Monodelphis domestica | ENSMODG00000007136 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000006182 | 3 retrocopies |