RetrogeneDB ID: | retro_ggor_1316 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 17:80682814..80683176(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS23 | ||
| Ensembl ID: | ENSGGOG00000025014 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.29 % |
| Parental protein coverage: | 86.01 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | LRTARKLRSHRRDQKWHDKQYKKAHLGTA-LKANPFGGASHAKGIVLEK-VGVEAKQPNSAIRKCVRVQL |
| LRT...L..H...QKW.DKQYKKAHLGTA.LKAN.FG.ASH.K..VLEK..GVEA..PNS.IRKC..VQL | |
| Retrocopy | LRT-KNLPVH*QEQKWNDKQYKKAHLGTA<LKANAFGNASHTKRTVLEK<IGVEAEWPNSNIRKCTIVQL |
| Parental | IKNGKKITAFVPNDGCLNFIEE-NDEVLVAG-FGRKGHAVGDIPGVRFKVVKVANVS |
| I.NGKKI..FVPNDGCLNFIEE..DE.LVA...G.KG..V.DIP.VRF.VV.VA.VS | |
| Retrocopy | IENGKKIIVFVPNDGCLNFIEE<KDEFLVAE<IGQKGGTVVDIPVVRFNVVRVASVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 86 .75 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 89 .63 RPM |
| SRP007412_heart | 0 .00 RPM | 50 .59 RPM |
| SRP007412_kidney | 0 .00 RPM | 265 .61 RPM |
| SRP007412_liver | 0 .00 RPM | 271 .35 RPM |
| SRP007412_testis | 0 .00 RPM | 118 .93 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3287 |
| Pan troglodytes | retro_ptro_2223 |
| Pongo abelii | retro_pabe_2716 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000013358 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011247 | 2 retrocopies | |
| Homo sapiens | ENSG00000186468 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025014 | 6 retrocopies |
retro_ggor_1316 , retro_ggor_2038, retro_ggor_2131, retro_ggor_2237, retro_ggor_2677, retro_ggor_286,
|
| Macaca mulatta | ENSMMUG00000003578 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000020255 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008114 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013203 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010363 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016580 | 12 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000008347 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000014133 | 1 retrocopy |