RetrogeneDB ID: | retro_ggor_311 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:148103109..148103412(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO1 | ||
| Ensembl ID: | ENSGGOG00000026439 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 82.18 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR |
| M.DQEAKPST.DL.DKKE.EY.KLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRF.FE.QR | |
| Retrocopy | M*DQEAKPSTDDLEDKKE*EYVKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFVFEDQR |
| Parental | IADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| IA..HT..ELGME.EDVIEVYQEQ....S.. | |
| Retrocopy | IAATHTIRELGME*EDVIEVYQEQMRSFSSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 36 .21 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 31 .05 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .10 RPM |
| SRP007412_kidney | 0 .00 RPM | 52 .95 RPM |
| SRP007412_liver | 0 .03 RPM | 35 .53 RPM |
| SRP007412_testis | 0 .00 RPM | 41 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_262 |
| Macaca mulatta | retro_mmul_450 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009859 | 6 retrocopies | |
| Canis familiaris | ENSCAFG00000012431 | 8 retrocopies | |
| Callithrix jacchus | ENSCJAG00000004961 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000012143 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024693 | 4 retrocopies | |
| Felis catus | ENSFCAG00000031005 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023769 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026439 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007504 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000000335 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000026021 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030345 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013083 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012817 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000016133 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000011968 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000025405 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000000642 | 4 retrocopies |