RetrogeneDB ID: | retro_cpor_1279 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_64:7870899..7871120(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUMO1 | ||
Ensembl ID: | ENSCPOG00000012143 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 62.67 % |
Parental protein coverage: | 76.29 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | KLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFL-FEGQRIADNHTPKELGMEEEDVIEVY |
.LK.IGQD.S.IH.K.K.T...KKLKE..CQ...V.MN.LR...FEG.RIA.NHTPKE...EEE.VIEVY | |
Retrocopy | ELKIIGQDISKIHSKMKITAQVKKLKEADCQKHVVLMNTLRVF<FEGHRIANNHTPKEV*IEEESVIEVY |
Parental | QEQTG |
QE..G | |
Retrocopy | QESVG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 16 .68 RPM |
SRP017611_kidney | 0 .00 RPM | 27 .11 RPM |
SRP017611_liver | 0 .00 RPM | 19 .41 RPM |
SRP040447_lung | 0 .00 RPM | 21 .21 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 12 .17 RPM |