RetrogeneDB ID: | retro_rnor_813 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 11:72340616..72340801(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Sumo1 | ||
| Ensembl ID: | ENSRNOG00000016133 | ||
| Aliases: | None | ||
| Description: | Small ubiquitin-related modifier 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5I0H3] |
| Percent Identity: | 73.02 % |
| Parental protein coverage: | 61.39 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | HFKVKMTT-HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG |
| HFKVK....H.KKL....CQRQG.PMNSLRFL.EGQR.ADNHT.KELGM.EED..EVY.EQTG | |
| Retrocopy | HFKVKNDN<HIKKLRG*HCQRQGLPMNSLRFLCEGQRRADNHTLKELGMGEEDEVEVY*EQTG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 59 .96 RPM |
| SRP017611_kidney | 0 .00 RPM | 60 .64 RPM |
| SRP017611_liver | 0 .00 RPM | 21 .58 RPM |