RetrogeneDB ID: | retro_ggor_893 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:96909407..96909761(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PAFAH1B2 | ||
Ensembl ID: | ENSGGOG00000028197 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70. % |
Parental protein coverage: | 52.17 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN |
M.Q.DSN.AAIPHA.EDIQGDDRW.SQHNRFVLD.KDK.P.VLFVGD.MVQLMQQ.EIWRELFSP.HALN | |
Retrocopy | MNQADSNTAAIPHAVEDIQGDDRWISQHNRFVLDGKDKKPNVLFVGDPMVQLMQQHEIWRELFSPIHALN |
Parental | FGIGGDTTRHVLWRLKNGELENIKPKVKLYLCIYTTNRERRKVSRGGCIK |
F....D.TRHVL...K..ELENIKPKV...L...T.N.E...V...G.IK | |
Retrocopy | FRTEED-TRHVL*KIKSRELENIKPKV-IVLWVKTNNHENTTVELEGRIK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .29 RPM | 21 .77 RPM |
SRP007412_cerebellum | 0 .00 RPM | 15 .92 RPM |
SRP007412_heart | 0 .00 RPM | 3 .44 RPM |
SRP007412_kidney | 0 .00 RPM | 10 .51 RPM |
SRP007412_liver | 0 .00 RPM | 5 .70 RPM |
SRP007412_testis | 0 .21 RPM | 22 .79 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1148 |
Pan troglodytes | retro_ptro_782 |
Pongo abelii | retro_pabe_953 |
Macaca mulatta | retro_mmul_892 |
Callithrix jacchus | retro_cjac_3325 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008628 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000013226 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012698 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011274 | 1 retrocopy | |
Felis catus | ENSFCAG00000029945 | 1 retrocopy | |
Homo sapiens | ENSG00000168092 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000028197 | 2 retrocopies |
retro_ggor_2893, retro_ggor_893 ,
|
Macaca mulatta | ENSMMUG00000002050 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000004246 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007337 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000003907 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000004318 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000018032 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000011403 | 1 retrocopy |