RetrogeneDB ID: | retro_mmul_892 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 11:98921205..98921580(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.13905 | ||
Ensembl ID: | ENSMMUG00000002050 | ||
Aliases: | None | ||
Description: | platelet-activating factor acetylhydrolase IB subunit beta [Source:RefSeq peptide;Acc:NP_001244668] |
Percent Identity: | 77.78 % |
Parental protein coverage: | 55.02 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN |
MSQ.DSN.AAIPHA.EDIQGDDRW.SQHNRFVLD.KDK.P.VLFVGD.MV.LMQQ.EIWRELFSP.HALN | |
Retrocopy | MSQADSNTAAIPHAVEDIQGDDRWISQHNRFVLDGKDKKPNVLFVGDPMV*LMQQHEIWRELFSPFHALN |
Parental | FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLIN |
FG...D.TRHVL...K..ELENIKPKVIVVWVGTNNHENTA.E...GI.AI...IN | |
Retrocopy | FGTEED-TRHVL*KRKSRELENIKPKVIVVWVGTNNHENTAVELESGIKAIIHSIN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 64 .88 RPM |
SRP007412_brain_prefrontal_cortex | 0 .32 RPM | 50 .77 RPM |
SRP007412_cerebellum | 0 .00 RPM | 59 .67 RPM |
SRP007412_heart | 0 .00 RPM | 18 .25 RPM |
SRP007412_kidney | 0 .00 RPM | 22 .89 RPM |
SRP007412_liver | 0 .00 RPM | 8 .87 RPM |
SRP007412_testis | 0 .87 RPM | 31 .13 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1148 |
Pan troglodytes | retro_ptro_782 |
Gorilla gorilla | retro_ggor_893 |
Pongo abelii | retro_pabe_953 |
Callithrix jacchus | retro_cjac_3325 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008628 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000013226 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012698 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011274 | 1 retrocopy | |
Felis catus | ENSFCAG00000029945 | 1 retrocopy | |
Homo sapiens | ENSG00000168092 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000028197 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000002050 | 2 retrocopies |
retro_mmul_2481, retro_mmul_892 ,
|
Macaca mulatta | ENSMMUG00000012172 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000004246 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007337 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000003907 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000004318 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000018032 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000011403 | 1 retrocopy |