RetrogeneDB ID: | retro_mmus_2838 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 6:72688016..72688215(-) | ||
Located in intron of: | ENSMUSG00000055799 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rpl37 | ||
Ensembl ID: | ENSMUSG00000041841 | ||
Aliases: | Rpl37, 3110005M08Rik | ||
Description: | ribosomal protein L37 [Source:MGI Symbol;Acc:MGI:1914531] |
Percent Identity: | 73.13 % |
Parental protein coverage: | 65.98 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | CGKCGYPAKRKR--KYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFR-EGTTPKPKRAAVAASSSS |
CG...Y........KYNWSAKAKR.NTT.TG.MRHLKIVY.RFR.GF..EGTTPKPKRAAVAASSSS | |
Retrocopy | CGSKAYHLQKLTCGKYNWSAKAKR*NTTRTGQMRHLKIVYHRFRRGFH>EGTTPKPKRAAVAASSSS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 65 .70 RPM |
SRP007412_cerebellum | 0 .00 RPM | 37 .21 RPM |
SRP007412_heart | 0 .00 RPM | 58 .93 RPM |
SRP007412_kidney | 0 .00 RPM | 45 .29 RPM |
SRP007412_liver | 0 .00 RPM | 67 .59 RPM |
SRP007412_testis | 0 .18 RPM | 51 .18 RPM |