RetrogeneDB ID: | retro_ocun_879 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 16:73126787..73127006(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL37 | ||
Ensembl ID: | ENSOCUG00000029674 | ||
Aliases: | None | ||
Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
Percent Identity: | 68.49 % |
Parental protein coverage: | 75.26 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | SKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAA |
SKA.HLQK.TCGKC.Y....KR...WSAKA.RR..TG.G.MRHL.IVYRRF.HGFREG.TPKPK....AA | |
Retrocopy | SKAHHLQKETCGKCAYITRCKRQRSWSAKARRRTITGSGGMRHLNIVYRRF*HGFREGATPKPKKETAAA |
Parental | SSS |
S.S | |
Retrocopy | SGS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 77 .48 RPM |
SRP017611_kidney | 0 .00 RPM | 140 .18 RPM |
SRP017611_liver | 0 .00 RPM | 43 .39 RPM |