RetrogeneDB ID: | retro_sscr_767 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 4:136750558..136750798(+) | ||
| Located in intron of: | ENSSSCG00000006911 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSSSCG00000025883 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
| Percent Identity: | 71.25 % |
| Parental protein coverage: | 82.47 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | LCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPK |
| LC..CGSKAY.LQK.TCGKCGYPAK.K..YNW.AKA.R.NT...G.MRHLKIV..RFRH.F.EGT.PKP. | |
| Retrocopy | LCHSCGSKAYRLQKLTCGKCGYPAK*KTEYNWGAKAQR*NTSRAGQMRHLKIVCGRFRHRFWEGTAPKPT |
| Parental | RAAVAASSSS |
| .AAV.AS.SS | |
| Retrocopy | MAAVVASASS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 569 .55 RPM |
| SRP014902_testis | 0 .00 RPM | 2139 .24 RPM |
| SRP018288_heart | 0 .00 RPM | 318 .38 RPM |
| SRP018288_kidney | 0 .00 RPM | 345 .66 RPM |
| SRP018288_liver | 0 .00 RPM | 317 .26 RPM |
| SRP018288_lung | 0 .00 RPM | 690 .48 RPM |
| SRP018856_adipose | 0 .00 RPM | 1378 .84 RPM |
| SRP035408_brain | 0 .13 RPM | 723 .95 RPM |
| SRP035408_liver | 0 .00 RPM | 476 .97 RPM |