RetrogeneDB ID: | retro_mmus_3436 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:34190909..34191136(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ube2d1 | ||
| Ensembl ID: | ENSMUSG00000019927 | ||
| Aliases: | Ube2d1, UBCH5 | ||
| Description: | ubiquitin-conjugating enzyme E2D 1 [Source:MGI Symbol;Acc:MGI:2384911] |
| Percent Identity: | 77.92 % |
| Parental protein coverage: | 51.7 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | FLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQW-SPALTVSKVLLSICSLLCDPNPDDPL |
| FLT..FP.DY.FKP.K.AFTTKIYH.NINSNGSI.LD.LRSQ..SPALT.S.V.LSICSLLCDPNPDD.L | |
| Retrocopy | FLTNQFPLDYTFKPLKVAFTTKIYHLNINSNGSIYLDNLRSQC<SPALTISNVHLSICSLLCDPNPDDLL |
| Parental | VPDIAQI |
| VP..AQI | |
| Retrocopy | VPETAQI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 37 .33 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 33 .35 RPM |
| SRP007412_heart | 0 .00 RPM | 24 .25 RPM |
| SRP007412_kidney | 0 .00 RPM | 17 .19 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .98 RPM |
| SRP007412_testis | 0 .00 RPM | 3 .52 RPM |