RetrogeneDB ID: | retro_mmus_3563 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | X:3518699..3518926(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Ube2d1 | ||
Ensembl ID: | ENSMUSG00000019927 | ||
Aliases: | Ube2d1, UBCH5 | ||
Description: | ubiquitin-conjugating enzyme E2D 1 [Source:MGI Symbol;Acc:MGI:2384911] |
Percent Identity: | 77.92 % |
Parental protein coverage: | 51.7 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | FLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQW-SPALTVSKVLLSICSLLCDPNPDDPL |
FLT..FP.DY.FKP.K.AFTTKIYH.NINSNGSI.LD.LRSQ..SPALT.S.V.LSICSLLCDPNPDD.L | |
Retrocopy | FLTNQFPLDYTFKPLKVAFTTKIYHLNINSNGSIYLDNLRSQC<SPALTISNVHLSICSLLCDPNPDDLL |
Parental | VPDIAQI |
VP..AQI | |
Retrocopy | VPETAQI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 37 .33 RPM |
SRP007412_cerebellum | 0 .00 RPM | 33 .35 RPM |
SRP007412_heart | 0 .00 RPM | 24 .25 RPM |
SRP007412_kidney | 0 .00 RPM | 17 .19 RPM |
SRP007412_liver | 0 .00 RPM | 5 .98 RPM |
SRP007412_testis | 0 .00 RPM | 3 .52 RPM |