RetrogeneDB ID: | retro_ptro_2197 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:143326484..143326714(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS12 | ||
Ensembl ID: | ENSPTRG00000018618 | ||
Aliases: | None | ||
Description: | Pan troglodytes ribosomal protein S12 (RPS12), mRNA. [Source:RefSeq mRNA;Acc:NM_001252509] |
Percent Identity: | 55.13 % |
Parental protein coverage: | 56.82 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | DEPMYVKLVEALCAEHQINLIKVD--DNKKLGEWVGLCKIDREGKPRKVVGC-SCVVVKDYGKESQAKDV |
DEP..VK..EALCAE.Q.N..K......K..G...G.C.IDREG.P...V.C..CV.VK..GKESQ...V | |
Retrocopy | DEPTSVKSGEALCAELQVNRLKGG**QKKPRGQVGGPCEIDREGRPCTAVSC<CCVIVKNCGKESQVEYV |
Parental | IEEYFKCK |
IEEYFKC. | |
Retrocopy | IEEYFKCR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 180 .07 RPM |
SRP007412_cerebellum | 0 .00 RPM | 84 .75 RPM |
SRP007412_heart | 0 .00 RPM | 79 .60 RPM |
SRP007412_kidney | 0 .00 RPM | 293 .11 RPM |
SRP007412_liver | 0 .00 RPM | 168 .52 RPM |
SRP007412_testis | 0 .00 RPM | 63 .12 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3249 |
Pongo abelii | retro_pabe_2694 |
Callithrix jacchus | retro_cjac_1778 |