RetrogeneDB ID: | retro_pabe_998 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 13:46510133..46510454(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FKBP1A | ||
Ensembl ID: | ENSPPYG00000010852 | ||
Aliases: | None | ||
Description: | FK506 binding protein 1A, 12kDa [Source:HGNC Symbol;Acc:3711] |
Percent Identity: | 82.24 % |
Parental protein coverage: | 99.07 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQ |
GVQVET.SPG.G.T.P.RGQTCV.HYTGMLE.GKK..S..DRNK.FKFMLGKQEVI.GWEEGVA..SVGQ | |
Retrocopy | GVQVETVSPGEGCTIPMRGQTCVLHYTGMLEGGKKIHSPLDRNKLFKFMLGKQEVI*GWEEGVA*KSVGQ |
Parental | RAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
R.KLTISPDYA.G.TGHPGIIPPHATLVFD.ELLKLE | |
Retrocopy | REKLTISPDYA*GTTGHPGIIPPHATLVFDMELLKLE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 176 .54 RPM |
SRP007412_cerebellum | 0 .00 RPM | 64 .69 RPM |
SRP007412_heart | 0 .00 RPM | 46 .15 RPM |
SRP007412_kidney | 0 .00 RPM | 83 .66 RPM |
SRP007412_liver | 0 .00 RPM | 80 .67 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1198 |
Pan troglodytes | retro_ptro_818 |
Gorilla gorilla | retro_ggor_933 |
Callithrix jacchus | retro_cjac_537 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000020908 | 4 retrocopies | |
Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
Homo sapiens | ENSG00000088832 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000002629 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004149 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000010852 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000012604 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013163 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |