RetrogeneDB ID: | retro_ptro_399 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:220655898..220656177(-) | ||
| Located in intron of: | ENSPTRG00000002161 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL36 | ||
| Ensembl ID: | ENSPTRG00000010338 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes ribosomal protein L36 (RPL36), mRNA. [Source:RefSeq mRNA;Acc:NM_001252514] |
| Percent Identity: | 65.98 % |
| Parental protein coverage: | 90.48 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAP-YERRAMELLKVSKDKRA |
| M.L.YPMAVGLNKGHKVTKNV.KPRHS.........TK..RDM.REVCGF.P..ER.A.ELLK.S.DK.A | |
| Retrocopy | MVLHYPMAVGLNKGHKVTKNVRKPRHS--QAGASANTKIARDMPREVCGFVP<IERCAVELLKLSQDKQA |
| Parental | LKFIKKRV-GTHIRAKRKREELSNVLA |
| LKFI.KRV.G.H...KRK.E.L.NV.A | |
| Retrocopy | LKFIRKRV>GAHFPPKRK*ESLCNVPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 127 .02 RPM |
| SRP007412_cerebellum | 0 .14 RPM | 50 .22 RPM |
| SRP007412_heart | 0 .00 RPM | 23 .58 RPM |
| SRP007412_kidney | 0 .00 RPM | 157 .46 RPM |
| SRP007412_liver | 0 .00 RPM | 102 .95 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .59 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_534 |
| Gorilla gorilla | retro_ggor_487 |
| Pongo abelii | retro_pabe_216 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012349 | 6 retrocopies | |
| Bos taurus | ENSBTAG00000001794 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017072 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005163 | 8 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015365 | 11 retrocopies | |
| Latimeria chalumnae | ENSLACG00000015161 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002743 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000001275 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006166 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000057863 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013689 | 15 retrocopies | |
| Otolemur garnettii | ENSOGAG00000027049 | 12 retrocopies | |
| Pan troglodytes | ENSPTRG00000010338 | 13 retrocopies | |
| Rattus norvegicus | ENSRNOG00000033473 | 5 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000013492 | 8 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000020518 | 2 retrocopies |