RetrogeneDB ID: | retro_dnov_2160 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_51746:771..1005(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL36 | ||
Ensembl ID: | ENSDNOG00000005163 | ||
Aliases: | None | ||
Description: | ribosomal protein L36 [Source:HGNC Symbol;Acc:13631] |
Percent Identity: | 82.05 % |
Parental protein coverage: | 74.29 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | HKVTKNVSKPRHSRRRGXLTKHTKFVRDMIREVCDFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAK |
.K.T.N.SKPRHSRR.G.LTK.TKF..DMIREVC.F.PYE.RAMELL.VSKDK.ALKFIKKRVGTHIRAK | |
Retrocopy | NKATRNTSKPRHSRRLGCLTKRTKFM*DMIREVCGFTPYEQRAMELLEVSKDKHALKFIKKRVGTHIRAK |
Parental | RKREELSN |
RKREELSN | |
Retrocopy | RKREELSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 334 .48 RPM |
SRP012922_cerebellum | 0 .00 RPM | 114 .51 RPM |
SRP012922_heart | 0 .00 RPM | 160 .33 RPM |
SRP012922_kidney | 0 .00 RPM | 292 .69 RPM |
SRP012922_liver | 0 .00 RPM | 167 .97 RPM |
SRP012922_lung | 0 .15 RPM | 361 .35 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 181 .22 RPM |
SRP012922_spleen | 0 .11 RPM | 430 .49 RPM |