RetrogeneDB ID: | retro_ptro_864 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 13:48032871..48033290(-) | ||
| Located in intron of: | ENSPTRG00000005864 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PCNP | ||
| Ensembl ID: | ENSPTRG00000015172 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 91.49 % |
| Parental protein coverage: | 78.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SNGGESSSRSAEKRSAEEEAADL-PTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTL |
| .NG.ESSSRSAEKRSAEEEAADL.PTKP.KIS.FGFAIGSQTTKKAS.ISIKLGSSKPKETVPTLAPKTL | |
| Retrocopy | TNGEESSSRSAEKRSAEEEAADL<PTKPAKISNFGFAIGSQTTKKASPISIKLGSSKPKETVPTLAPKTL |
| Parental | SVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD |
| SVAAAFNEDEDSE.EE.PPEAKMRMKNI.RDTPTSAGPNSFNKGKHGFSDNQKLWE.NIKSHLGN..DQD | |
| Retrocopy | SVAAAFNEDEDSESEERPPEAKMRMKNIARDTPTSAGPNSFNKGKHGFSDNQKLWEWNIKSHLGNLYDQD |
| Parental | N |
| N | |
| Retrocopy | N |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .09 RPM | 59 .58 RPM |
| SRP007412_cerebellum | 0 .18 RPM | 101 .02 RPM |
| SRP007412_heart | 0 .06 RPM | 48 .38 RPM |
| SRP007412_kidney | 0 .03 RPM | 53 .95 RPM |
| SRP007412_liver | 0 .00 RPM | 30 .15 RPM |
| SRP007412_testis | 0 .21 RPM | 36 .46 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1264 |
| Gorilla gorilla | retro_ggor_994 |
| Pongo abelii | retro_pabe_1051 |
| Macaca mulatta | retro_mmul_1312 |
| Callithrix jacchus | retro_cjac_401 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007972 | 11 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000508 | 6 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008873 | 5 retrocopies | |
| Homo sapiens | ENSG00000081154 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025423 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000005518 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000008072 | 10 retrocopies | |
| Macaca mulatta | ENSMMUG00000017782 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000011696 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000071533 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003224 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011110 | 7 retrocopies | |
| Procavia capensis | ENSPCAG00000007007 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000013591 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000015172 | 3 retrocopies |
retro_ptro_676, retro_ptro_790, retro_ptro_864 ,
|
| Rattus norvegicus | ENSRNOG00000028411 | 1 retrocopy |