RetrogeneDB ID: | retro_rnor_1948 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 4:9728792..9729131(+) | ||
| Located in intron of: | ENSRNOG00000021441 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Tceb2 | ||
| Ensembl ID: | ENSRNOG00000004814 | ||
| Aliases: | None | ||
| Description: | Transcription elongation factor B polypeptide 2 [Source:UniProtKB/Swiss-Prot;Acc:P62870] |
| Percent Identity: | 83.62 % |
| Parental protein coverage: | 98.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAP |
| .FLMI.RHKTTIFT..KE..TVFELKRI.EGI.K.PPEEQRLYK...LL.DGKTLG.CGFTSQTA.PQAP | |
| Retrocopy | MFLMIQRHKTTIFTYTKELTTVFELKRIMEGIRKPPPEEQRLYK---LLNDGKTLGKCGFTSQTAGPQAP |
| Parental | ATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ |
| ATVGLAFRADDTFEAL.IEPFSSPPELPDVMKP.DSGGSA..QAVQ | |
| Retrocopy | ATVGLAFRADDTFEALCIEPFSSPPELPDVMKPRDSGGSASAQAVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .10 RPM |
| SRP017611_kidney | 0 .00 RPM | 25 .47 RPM |
| SRP017611_liver | 0 .07 RPM | 18 .62 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019543 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015347 | 10 retrocopies | |
| Cavia porcellus | ENSCPOG00000021024 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004711 | 2 retrocopies | |
| Homo sapiens | ENSG00000103363 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015306 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016536 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000015265 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000055839 | 7 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009471 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010116 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007013 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007663 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004814 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000008061 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015454 | 5 retrocopies |