RetrogeneDB ID: | retro_cfam_680 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 15:24674809..24675125(-) | ||
Located in intron of: | ENSCAFG00000005914 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCAFG00000012395 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 75.7 % |
Parental protein coverage: | 84.8 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | KSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVV-SERLKIRGS |
KSAK.DKDPVNK.GGKAKKKKWSKGKV.DK.N.LVL.DKAT.DKLCKEVPN....T.....S.RLKI.G. | |
Retrocopy | KSAKNDKDPVNKPGGKAKKKKWSKGKVWDKSNSLVLPDKATHDKLCKEVPNHE-LTTPAI>S*RLKIGGT |
Parental | LARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAP |
..RAALQELLS..LIKLVSKHRAQVIYTR..KGG.AP | |
Retrocopy | PVRAALQELLSEALIKLVSKHRAQVIYTRSAKGGNAP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 259 .09 RPM |
SRP017611_brain | 0 .00 RPM | 78 .28 RPM |
SRP017611_kidney | 0 .00 RPM | 747 .08 RPM |
SRP017611_liver | 0 .00 RPM | 187 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000051 | 5 retrocopies | |
Canis familiaris | ENSCAFG00000012395 | 3 retrocopies |
retro_cfam_500, retro_cfam_680 , retro_cfam_984,
|
Cavia porcellus | ENSCPOG00000013298 | 2 retrocopies | |
Felis catus | ENSFCAG00000001151 | 3 retrocopies | |
Latimeria chalumnae | ENSLACG00000017531 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000017117 | 6 retrocopies | |
Macropus eugenii | ENSMEUG00000014185 | 3 retrocopies | |
Microcebus murinus | ENSMICG00000002687 | 8 retrocopies | |
Myotis lucifugus | ENSMLUG00000004752 | 15 retrocopies | |
Macaca mulatta | ENSMMUG00000016894 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000013334 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000004960 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000016194 | 9 retrocopies | |
Sus scrofa | ENSSSCG00000015103 | 12 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000020783 | 3 retrocopies | |
Vicugna pacos | ENSVPAG00000000266 | 4 retrocopies |