RetrogeneDB ID: | retro_cjac_2312 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 4:17879288..17879633(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AP1S2 | ||
Ensembl ID: | ENSCJAG00000004393 | ||
Aliases: | None | ||
Description: | adaptor-related protein complex 1, sigma 2 subunit [Source:HGNC Symbol;Acc:560] |
Percent Identity: | 97.39 % |
Parental protein coverage: | 73.25 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSV |
KKITRELVQT.LARKPKMCSFLEWRDLKIVYKRYASL.FCCAIEDQDNELITLEIIHRYVELLDKYF.SV | |
Retrocopy | KKITRELVQTILARKPKMCSFLEWRDLKIVYKRYASL*FCCAIEDQDNELITLEIIHRYVELLDKYFVSV |
Parental | CELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQE |
CELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQE | |
Retrocopy | CELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .27 RPM | 12 .56 RPM |
SRP051959_heart | 0 .54 RPM | 18 .86 RPM |
SRP051959_kidney | 0 .16 RPM | 12 .82 RPM |
SRP051959_liver | 0 .24 RPM | 7 .67 RPM |
SRP051959_lung | 0 .60 RPM | 28 .61 RPM |
SRP051959_lymph_node | 0 .46 RPM | 23 .26 RPM |
SRP051959_skeletal_muscle | 0 .28 RPM | 5 .70 RPM |
SRP051959_spleen | 0 .80 RPM | 50 .06 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000020420 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004393 | 1 retrocopy |
retro_cjac_2312 ,
|
Callithrix jacchus | ENSCJAG00000005786 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012352 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000013888 | 1 retrocopy | |
Homo sapiens | ENSG00000182287 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014055 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017197 | 7 retrocopies | |
Otolemur garnettii | ENSOGAG00000011342 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000000733 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000010218 | 1 retrocopy | |
Sorex araneus | ENSSARG00000000117 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000013119 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000012142 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008517 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000008834 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000005290 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007642 | 1 retrocopy |