RetrogeneDB ID: | retro_cjac_2371 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 4:117275317..117275683(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAP1B | ||
Ensembl ID: | ENSCJAG00000007261 | ||
Aliases: | None | ||
Description: | RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:9857] |
Percent Identity: | 74.8 % |
Parental protein coverage: | 66.85 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | YDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQIL |
.DPTI......QVE..AQ..MLEIL.T.GTEQF.AMRDLY.KN.QGFAL.Y.I..QSTF.DLQDLREQ.L | |
Retrocopy | HDPTIDNTTENQVEIHAQLYMLEILNTTGTEQFIAMRDLYIKNEQGFALAYTIQPQSTFYDLQDLREQSL |
Parental | RVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINV |
.VKDTDDV.MIL.GNK.DLED.RVVGKEQGQNLARQWNNCA.LES..K.KINV | |
Retrocopy | QVKDTDDVTMIL-GNKGDLEDKRVVGKEQGQNLARQWNNCAILESFPK*KINV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 81 .38 RPM |
SRP051959_heart | 0 .00 RPM | 39 .41 RPM |
SRP051959_kidney | 0 .00 RPM | 59 .21 RPM |
SRP051959_liver | 0 .00 RPM | 48 .00 RPM |
SRP051959_lung | 0 .00 RPM | 114 .80 RPM |
SRP051959_lymph_node | 0 .00 RPM | 109 .97 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 25 .48 RPM |
SRP051959_spleen | 0 .00 RPM | 116 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008637 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007261 | 3 retrocopies |
retro_cjac_1435, retro_cjac_2371 , retro_cjac_607,
|
Callithrix jacchus | ENSCJAG00000007630 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013392 | 7 retrocopies | |
Callithrix jacchus | ENSCJAG00000036517 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000008272 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000025649 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000016460 | 1 retrocopy | |
Mus musculus | ENSMUSG00000052681 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000003573 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000005746 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000011497 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030014 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000013380 | 4 retrocopies |