RetrogeneDB ID: | retro_cjac_607 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 1:120647264..120647669(-) | ||
| Located in intron of: | ENSCJAG00000012733 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAP1B | ||
| Ensembl ID: | ENSCJAG00000007261 | ||
| Aliases: | None | ||
| Description: | RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:9857] |
| Percent Identity: | 88.15 % |
| Parental protein coverage: | 73.37 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | QCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCD |
| QCMLEI.DTAG.E.FTAMRDLYMKNGQG.ALVYSITAQ.T.N.LQDLRE..L.VKDTDDVPMILVGN.CD | |
| Retrocopy | QCMLEIWDTAGME*FTAMRDLYMKNGQGSALVYSITAQFTCNNLQDLRE*SLSVKDTDDVPMILVGNNCD |
| Parental | LEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL |
| LEDERVVGK.QGQNLARQWNNCAFLESSAKSKI..NEIFYDLV.QINRKTPVPGKARKK.SCQLL | |
| Retrocopy | LEDERVVGKKQGQNLARQWNNCAFLESSAKSKISFNEIFYDLVQQINRKTPVPGKARKKLSCQLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 81 .38 RPM |
| SRP051959_heart | 0 .16 RPM | 39 .41 RPM |
| SRP051959_kidney | 0 .07 RPM | 59 .21 RPM |
| SRP051959_liver | 0 .00 RPM | 48 .00 RPM |
| SRP051959_lung | 0 .05 RPM | 114 .80 RPM |
| SRP051959_lymph_node | 0 .07 RPM | 109 .97 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 25 .48 RPM |
| SRP051959_spleen | 0 .11 RPM | 116 .01 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4234 |
| Pan troglodytes | retro_ptro_2877 |
| Gorilla gorilla | retro_ggor_2836 |
| Pongo abelii | retro_pabe_3403 |
| Macaca mulatta | retro_mmul_1151 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008637 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007261 | 3 retrocopies |
retro_cjac_1435, retro_cjac_2371, retro_cjac_607 ,
|
| Callithrix jacchus | ENSCJAG00000007630 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013392 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000036517 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008272 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025649 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000016460 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000052681 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003573 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000005746 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000011497 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030014 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013380 | 4 retrocopies |