RetrogeneDB ID: | retro_cpor_1036 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_4:24359461..24359844(-) | ||
Located in intron of: | ENSCPOG00000008536 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCPOG00000002251 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 83.08 % |
Parental protein coverage: | 66.84 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | SSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILG |
S.SNQQT..ETNTPKK.ESKVS.S.NSKLLSTSAKRIQKELADITL.P..NCSA.PKGDNIYEWRSTILG | |
Retrocopy | SPSNQQTKEETNTPKK-ESKVSISRNSKLLSTSAKRIQKELADITLNPLSNCSASPKGDNIYEWRSTILG |
Parental | PPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVI-CLDILKDNWSPALT |
PP.SVYEGG.FFLDITFTPEYPFKPPKVTF.T.IYHCN.NSQ.VI.CLDI.KDN.SP... | |
Retrocopy | PPRSVYEGGIFFLDITFTPEYPFKPPKVTFQTPIYHCNTNSQRVI<CLDIMKDNYSPTIS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 15 .87 RPM |
SRP017611_kidney | 0 .00 RPM | 11 .93 RPM |
SRP017611_liver | 0 .00 RPM | 7 .14 RPM |
SRP040447_lung | 0 .00 RPM | 23 .88 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 14 .63 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003515 | 2 retrocopies | |
Ciona intestinalis | ENSCING00000006860 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000002251 | 2 retrocopies |
retro_cpor_1036 , retro_cpor_52,
|
Cavia porcellus | ENSCPOG00000006044 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000015441 | 1 retrocopy | |
Felis catus | ENSFCAG00000024719 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000008393 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000004150 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000014517 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021774 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006026 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000007527 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000014693 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000001773 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000008794 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000001416 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000025799 | 2 retrocopies |