RetrogeneDB ID: | retro_dnov_1198 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_16207:48128..48356(+) | ||
Located in intron of: | ENSDNOG00000003575 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D3 | ||
Ensembl ID: | ENSDNOG00000009320 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2D 3 [Source:HGNC Symbol;Acc:12476] |
Percent Identity: | 76.32 % |
Parental protein coverage: | 52.52 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | PAQCSAGPVGDDMFHWQATIMGPND---SPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSI |
PAQCS..PVG.DMFHWQATIMGPND......QGGVFF.T.HFPTD..FKP.KVAF.TR..HPNINSNGSI | |
Retrocopy | PAQCSTSPVGNDMFHWQATIMGPNDIMTAHNQGGVFFWTNHFPTDHSFKPLKVAFITRM*HPNINSNGSI |
Parental | CLDILR |
CL.ILR | |
Retrocopy | CLSILR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 44 .92 RPM |
SRP012922_cerebellum | 0 .14 RPM | 32 .86 RPM |
SRP012922_heart | 0 .00 RPM | 30 .16 RPM |
SRP012922_kidney | 0 .27 RPM | 28 .75 RPM |
SRP012922_liver | 0 .00 RPM | 33 .28 RPM |
SRP012922_lung | 0 .15 RPM | 42 .15 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 52 .27 RPM |
SRP012922_spleen | 0 .00 RPM | 60 .89 RPM |