RetrogeneDB ID: | retro_dnov_1198 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_16207:48128..48356(+) | ||
| Located in intron of: | ENSDNOG00000003575 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2D3 | ||
| Ensembl ID: | ENSDNOG00000009320 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2D 3 [Source:HGNC Symbol;Acc:12476] |
| Percent Identity: | 76.32 % |
| Parental protein coverage: | 52.52 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | PAQCSAGPVGDDMFHWQATIMGPND---SPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSI |
| PAQCS..PVG.DMFHWQATIMGPND......QGGVFF.T.HFPTD..FKP.KVAF.TR..HPNINSNGSI | |
| Retrocopy | PAQCSTSPVGNDMFHWQATIMGPNDIMTAHNQGGVFFWTNHFPTDHSFKPLKVAFITRM*HPNINSNGSI |
| Parental | CLDILR |
| CL.ILR | |
| Retrocopy | CLSILR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 44 .92 RPM |
| SRP012922_cerebellum | 0 .14 RPM | 32 .86 RPM |
| SRP012922_heart | 0 .00 RPM | 30 .16 RPM |
| SRP012922_kidney | 0 .27 RPM | 28 .75 RPM |
| SRP012922_liver | 0 .00 RPM | 33 .28 RPM |
| SRP012922_lung | 0 .15 RPM | 42 .15 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 52 .27 RPM |
| SRP012922_spleen | 0 .00 RPM | 60 .89 RPM |