RetrogeneDB ID: | retro_dnov_1510 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_2207:115730..116038(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP3 | ||
Ensembl ID: | ENSDNOG00000000511 | ||
Aliases: | None | ||
Description: | fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [Source:HGNC Symbol;Acc:3557] |
Percent Identity: | 57.41 % |
Parental protein coverage: | 99.07 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | VGFAIRQVGAMTKPFTIIEQ-NGDTITIKTQSTFKSTEISFQLGVEFDETTADDRKVKSIVTLDGGKLVH |
..FA..QV.AMTK..TII...NGD.I..K.QSTFK..EIS....V.FDETTA.DRKV...VT..GG...H | |
Retrocopy | IDFATGQVAAMTKTTTIIGK<NGDSINTKVQSTFKNMEISIKVSV*FDETTAGDRKVNRTVTFEGGNF-H |
Parental | VQKWNGQETTLVRELKDGKLILTLTLGNVVSTRIYEKE |
V.KW..QE...V.EL..GKLIL.LT.G...STR.Y.KE | |
Retrocopy | V*KWDRQEMAFVQELNHGKLILILTCG---STRTY*KE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 29 .17 RPM |
SRP012922_cerebellum | 0 .00 RPM | 18 .15 RPM |
SRP012922_heart | 0 .00 RPM | 761 .99 RPM |
SRP012922_kidney | 0 .27 RPM | 47 .64 RPM |
SRP012922_liver | 0 .00 RPM | 0 .15 RPM |
SRP012922_lung | 0 .00 RPM | 7 .94 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 656 .68 RPM |
SRP012922_spleen | 0 .00 RPM | 0 .92 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000016819 | 2 retrocopies | |
Danio rerio | ENSDARG00000023290 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000511 | 2 retrocopies |
retro_dnov_1510 , retro_dnov_2482,
|
Dasypus novemcinctus | ENSDNOG00000018066 | 5 retrocopies | |
Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
Homo sapiens | ENSG00000121769 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000012501 | 6 retrocopies | |
Microcebus murinus | ENSMICG00000009359 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
Mus musculus | ENSMUSG00000028773 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000001586 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000001616 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012879 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003842 | 3 retrocopies |