RetrogeneDB ID: | retro_dnov_2641 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_93376:3950..4192(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSDNOG00000011217 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
| Percent Identity: | 84.15 % |
| Parental protein coverage: | 98.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LRQIVGQAKKHPSL-IPLFVFIGTGATGAALYVLRLAMFNPDVSWDRKNNPEPWNKLGPNEQYKFYSVNV |
| L.Q.VGQA.KHPSL..PLF.F.GTGATGAAL.VLRLAMF.PDVSW.RKNNPEPW.KLGPNE.YKFYSVNV | |
| Retrocopy | LCQVVGQAEKHPSL<APLFAFAGTGATGAALCVLRLAMFKPDVSWERKNNPEPWDKLGPNERYKFYSVNV |
| Parental | DYSKLKKEGPEF |
| DYSKLK.EGPEF | |
| Retrocopy | DYSKLKREGPEF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 170 .55 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 318 .52 RPM |
| SRP012922_heart | 0 .00 RPM | 1647 .89 RPM |
| SRP012922_kidney | 0 .00 RPM | 501 .32 RPM |
| SRP012922_liver | 0 .15 RPM | 245 .68 RPM |
| SRP012922_lung | 0 .15 RPM | 179 .76 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1072 .95 RPM |
| SRP012922_spleen | 0 .00 RPM | 157 .61 RPM |