RetrogeneDB ID: | retro_mdom_1095 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 3:91222507..91222704(-) | ||
Located in intron of: | ENSMODG00000000878 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSMODG00000014107 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
Percent Identity: | 56.16 % |
Parental protein coverage: | 86.59 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | HPSLIPLFLFIGAGGGGATLYVMRLALFNPD-VSWDRKNNPEPWNKLNPTDQYKFYSVNVDY-SKLKKEG |
HPSL.....FIGAGG.G..LYV..L..F.PD...W.RKNN.E..N.......YKFY.VNVDY..KLKK.G | |
Retrocopy | HPSLL---VFIGAGGRGSALYVFDLEIFSPD<WCWNRKNNQESCN---TSE*YKFYLVNVDYHHKLKKNG |
Parental | PEF |
P.F | |
Retrocopy | P*F |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |