RetrogeneDB ID: | retro_ggor_249 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:67053199..67053440(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSGGOG00000001437 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:Q0MQ98] |
| Percent Identity: | 60.98 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDKSKPE-PWNKLGPNDQYKFYSVNV |
| ML.Q..GQAK...SLIPLFVF.G...T.A.LY.L.LA.........K..P..P.NKLG.N.QYKFYSVNV | |
| Retrocopy | MLHQVLGQAKEL-SLIPLFVFNGARGTRAALYVLHLAFQSRCQLGQKE*PR>P*NKLGSNEQYKFYSVNV |
| Parental | DYSKLKKERPDF |
| DYSKLKK..PDF | |
| Retrocopy | DYSKLKKDGPDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 138 .01 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 80 .10 RPM |
| SRP007412_heart | 0 .00 RPM | 168 .29 RPM |
| SRP007412_kidney | 0 .00 RPM | 108 .48 RPM |
| SRP007412_liver | 0 .00 RPM | 64 .92 RPM |
| SRP007412_testis | 0 .00 RPM | 23 .52 RPM |