RetrogeneDB ID: | retro_pabe_2296 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:29829528..29829774(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSPPYG00000017780 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
| Percent Identity: | 80.49 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MLRQILSQAKKHPSLIPLFVFIGTGASGATLYLLRLALFNPDVCWDR-NNPEPWNKLGPNDQYKFYSVNV |
| .LRQI.SQ.KKHPSL.PLFVFIG.G..GA.LYLL.LALFNPDV.WDR.NN.E..NKL.PNDQYKFYSVNV | |
| Retrocopy | ILRQIISQVKKHPSLMPLFVFIGVGGTGAALYLLFLALFNPDVSWDRKNNSES*NKLDPNDQYKFYSVNV |
| Parental | DYSKLKKERPDF |
| DYSKLKKE.PDF | |
| Retrocopy | DYSKLKKEGPDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 157 .08 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 123 .06 RPM |
| SRP007412_heart | 0 .00 RPM | 305 .28 RPM |
| SRP007412_kidney | 0 .00 RPM | 125 .86 RPM |
| SRP007412_liver | 0 .00 RPM | 57 .07 RPM |