RetrogeneDB ID: | retro_cjac_3291 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 9:36176384..36176602(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSCJAG00000000748 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001240705] |
Percent Identity: | 63.51 % |
Parental protein coverage: | 89.02 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | ILGQAKKHPSLIPLFVFIGAGGGGAALYLLRLALFN-PDVCWDKKNNPEPWNKLGPNDQYKFYSVNVDYS |
IL.QAKKHPSLI.L..FIGAG...AALY.L.LALFN..DV....KNN..P..KLG.N..YKF.SVNV.YS | |
Retrocopy | ILSQAKKHPSLILLLIFIGAGVPRAALYVLHLALFN<SDVSR*RKNNSKP*DKLGANN*YKFDSVNVGYS |
Parental | KLKK |
.L.. | |
Retrocopy | NLAR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 26 .27 RPM |
SRP051959_heart | 0 .00 RPM | 99 .24 RPM |
SRP051959_kidney | 0 .00 RPM | 36 .14 RPM |
SRP051959_liver | 0 .00 RPM | 37 .71 RPM |
SRP051959_lung | 0 .00 RPM | 10 .28 RPM |
SRP051959_lymph_node | 0 .00 RPM | 13 .54 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 112 .79 RPM |
SRP051959_spleen | 0 .00 RPM | 16 .47 RPM |