RetrogeneDB ID: | retro_pabe_3339 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 8:66768793..66769033(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSPPYG00000017780 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
Percent Identity: | 78.75 % |
Parental protein coverage: | 98.77 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MLRQILSQAKKHPSLIPLFVFIGTGASGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVD |
MLR.ILSQAKKHPSLIPLF.FIG.G..GA....L.LA.FN.DV.WDR.NPEPWNK.GPNDQYKFYS.NVD | |
Retrocopy | MLR*ILSQAKKHPSLIPLFTFIGAGGTGAAQFVLHLASFNTDVSWDRKNPEPWNKWGPNDQYKFYSMNVD |
Parental | YSKLKKERPD |
YSKLKKE.PD | |
Retrocopy | YSKLKKEGPD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 157 .08 RPM |
SRP007412_cerebellum | 0 .00 RPM | 123 .06 RPM |
SRP007412_heart | 0 .00 RPM | 305 .28 RPM |
SRP007412_kidney | 0 .00 RPM | 125 .86 RPM |
SRP007412_liver | 0 .00 RPM | 57 .07 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4067 |
Pan troglodytes | retro_ptro_2756 |