RetrogeneDB ID: | retro_ptro_1745 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 2B:220835495..220835702(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSPTRG00000018934 | ||
Aliases: | None | ||
Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001079924] |
Percent Identity: | 84.06 % |
Parental protein coverage: | 83.95 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDR-NNPEPWNKLGPNDQYKFYSVN |
ML.QII.QA..HPSLIPLFVFIGTG.TGA.LYLL.LAL.NPDV.WDR.NNPEPWNKLGPN.QYKFYSVN | |
Retrocopy | MLCQIISQATTHPSLIPLFVFIGTGDTGAALYLLHLALINPDVSWDRKNNPEPWNKLGPNGQYKFYSVN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 238 .82 RPM |
SRP007412_cerebellum | 0 .00 RPM | 80 .80 RPM |
SRP007412_heart | 0 .00 RPM | 209 .21 RPM |
SRP007412_kidney | 0 .00 RPM | 128 .12 RPM |
SRP007412_liver | 0 .07 RPM | 39 .74 RPM |
SRP007412_testis | 0 .00 RPM | 7 .48 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2386 |