RetrogeneDB ID: | retro_ggor_1425 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 19:9969724..9970161(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2L3 | ||
Ensembl ID: | ENSGGOG00000028073 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 89.26 % |
Parental protein coverage: | 99.32 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | KELEEIR-KCGMKNF-RNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYH |
.ELEEI..KCGMKNF.RNIQVDEANLLT.QGLIVPDN.PYD...FRIEINFPAEYPFK.PKITFKTKIY. | |
Retrocopy | EELEEIA<KCGMKNF>RNIQVDEANLLT*QGLIVPDNSPYD*VTFRIEINFPAEYPFKLPKITFKTKIYP |
Parental | PNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKK |
PNIDEKGQVCL.VISAENWKPATKTDQVIQSL.ALVNDPQPEHPLRADLAEEYSKD.KKFCKNAEEFTKK | |
Retrocopy | PNIDEKGQVCLSVISAENWKPATKTDQVIQSLTALVNDPQPEHPLRADLAEEYSKDCKKFCKNAEEFTKK |
Parental | YGE-KRPVD |
YGE.K.PVD | |
Retrocopy | YGE<K*PVD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .38 RPM | 79 .94 RPM |
SRP007412_cerebellum | 1 .06 RPM | 76 .16 RPM |
SRP007412_heart | 0 .09 RPM | 22 .11 RPM |
SRP007412_kidney | 0 .61 RPM | 60 .97 RPM |
SRP007412_liver | 0 .21 RPM | 32 .34 RPM |
SRP007412_testis | 0 .21 RPM | 61 .33 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000015284 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015818 | 9 retrocopies | |
Dipodomys ordii | ENSDORG00000011406 | 1 retrocopy | |
Equus caballus | ENSECAG00000019274 | 1 retrocopy | |
Felis catus | ENSFCAG00000008008 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001368 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000008393 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000010832 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000028073 | 3 retrocopies |
retro_ggor_1425 , retro_ggor_861, retro_ggor_924,
|
Myotis lucifugus | ENSMLUG00000001547 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017665 | 2 retrocopies | |
Mus musculus | ENSMUSG00000038965 | 10 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000192 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000011602 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014114 | 1 retrocopy | |
Tetraodon nigroviridis | ENSTNIG00000010600 | 1 retrocopy | |
Takifugu rubripes | ENSTRUG00000003392 | 1 retrocopy |